PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_015877082.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rhamnaceae; Paliureae; Ziziphus
Family LBD
Protein Properties Length: 232aa    MW: 25283.9 Da    PI: 7.1204
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_015877082.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260136.97.1e-43771761100
          DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaela 95 
                     +CaaCk+lrr+C+++Cvlapyfp ++p kf n+h++FGasn++k+l+++pe++r da+ss+vyeA+ar+rdPvyG++g i +lq+q+++l+a+la
  XP_015877082.1  77 PCAACKILRRRCVDKCVLAPYFPPTDPLKFTNAHRVFGASNIIKFLQEIPESQRADAVSSMVYEANARIRDPVYGCAGAICNLQKQISELQAQLA 171
                     7********************************************************************************************** PP

          DUF260  96 llkee 100
                     ++++e
  XP_015877082.1 172 KAQAE 176
                     *9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.14376177IPR004883Lateral organ boundaries, LOB
PfamPF031953.8E-4377174IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 232 aa     Download sequence    Send to blast
MEFNRQSSPT ATLTPPRITI PTPFSYSSPS SNSPSPTTSP QYSPTAIPSP SHQSAPMTVK  60
GLASPPPPPS PPVVVSPCAA CKILRRRCVD KCVLAPYFPP TDPLKFTNAH RVFGASNIIK  120
FLQEIPESQR ADAVSSMVYE ANARIRDPVY GCAGAICNLQ KQISELQAQL AKAQAELVNM  180
QCQQTNLIAL ICMDMTQSSQ ELPNLPQQVP WVDTTCFLDD NVLGNSWEPL WT
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015877082.11e-169PREDICTED: LOB domain-containing protein 1-like
SwissprotQ9LQR08e-75LBD1_ARATH; LOB domain-containing protein 1
TrEMBLW9RZL72e-97W9RZL7_9R
STRINGPOPTR_0008s04350.13e-94(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF130334106
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07900.12e-62LOB domain-containing protein 1